(data stored in ACNUC7421 zone)

EMBL: CP000438.PE195

CP000438.PE195       Location/Qualifiers
FT   CDS             219291..220190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15642"
FT                   /db_xref="GOA:A0A0H2ZLU3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLU3"
FT                   /protein_id="ABJ15642.1"
FT                   /translation="MSQSATARQPEPEVAEAFRITPLEAPLGAEVRGLDARRPLAPEQV
FT                   LALKQALREHHILVFRQQHLDDEQYLRFATLFGSVFQPPADIPVLSSGGDGKVPEIVKV
FT                   ANTGDGELGNFALPAHIDHQWTPVPSSGSLLYALEVPSSGGETRFTNLARAYESLDEAT
FT                   RREIDGLRLINYNPFIRLREGGYGGGFATYRTPDIEPIQGSEHPLVRTHPESGRRVLFL
FT                   SAHTEVEIPGYDPARGQALIGRLREHLARPELSYSHAWSVGDIVWWDNQAVLHARNAFP
FT                   ASERRRLKRISLAGSRPF"
     MSQSATARQP EPEVAEAFRI TPLEAPLGAE VRGLDARRPL APEQVLALKQ ALREHHILVF        60
     RQQHLDDEQY LRFATLFGSV FQPPADIPVL SSGGDGKVPE IVKVANTGDG ELGNFALPAH       120
     IDHQWTPVPS SGSLLYALEV PSSGGETRFT NLARAYESLD EATRREIDGL RLINYNPFIR       180
     LREGGYGGGF ATYRTPDIEP IQGSEHPLVR THPESGRRVL FLSAHTEVEI PGYDPARGQA       240
     LIGRLREHLA RPELSYSHAW SVGDIVWWDN QAVLHARNAF PASERRRLKR ISLAGSRPF        299
//

If you have problems or comments...

PBIL Back to PBIL home page