(data stored in ACNUC7421 zone)

EMBL: CP000438.PE196

CP000438.PE196       Location/Qualifiers
FT   CDS             220837..221955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02450"
FT                   /product="putative NAD(P) transhydrogenase, subunit alpha
FT                   part 1"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15149"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK8"
FT                   /protein_id="ABJ15149.1"
FT                   /translation="MQIGVPLETHAGETRVSATPETVKKLIGQGHQVIVQSGAGVNASQ
FT                   PDSAYEAAGATIGSAAEAFGADLVLKVVAPSAAELAQMKSGAVLVGMLNPFDNENIARM
FT                   AERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVMLAANHYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPYETDEERE
FT                   CAEGVGGYARPMPASWMERQAKAVHERAKQSDIVITTALIPGRKAPTLLHEATVAEMKP
FT                   GSVVIDLAAAQGGNCPLTEADQVVVRHGVTIVGHSNLAALVPADASALYARNILDFLKL
FT                   TLNAEGFSVNLEDDIVAACLMCRDGQAVRKNG"
     MQIGVPLETH AGETRVSATP ETVKKLIGQG HQVIVQSGAG VNASQPDSAY EAAGATIGSA        60
     AEAFGADLVL KVVAPSAAEL AQMKSGAVLV GMLNPFDNEN IARMAERGIT AFALEAAPRT       120
     SRAQSLDVLS SQANIAGYKA VMLAANHYPR FMPMLMTAAG TVKAARVLIL GAGVAGLQAI       180
     ATAKRLGAVI EASDVRPAVK EQIESLGAKF VDVPYETDEE RECAEGVGGY ARPMPASWME       240
     RQAKAVHERA KQSDIVITTA LIPGRKAPTL LHEATVAEMK PGSVVIDLAA AQGGNCPLTE       300
     ADQVVVRHGV TIVGHSNLAA LVPADASALY ARNILDFLKL TLNAEGFSVN LEDDIVAACL       360
     MCRDGQAVRK NG                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page