(data stored in ACNUC7421 zone)

EMBL: CP000438.PE197

CP000438.PE197       Location/Qualifiers
FT   CDS             222031..222339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02460"
FT                   /product="putative NAD(P) transhydrogenase, subunit alpha
FT                   part 2"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15150"
FT                   /db_xref="GOA:A0A0H2ZK03"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK03"
FT                   /protein_id="ABJ15150.1"
FT                   /translation="MDIISDGIYNLIIFVLAVYVGYHVVWNVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTVTPLGKAMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAGGH"
     MDIISDGIYN LIIFVLAVYV GYHVVWNVTP ALHTPLMAVT NAISAIVIVG AMLAAALTVT        60
     PLGKAMGTLA VALAAVNVFG GFLVTRRMLE MFKKKAPKAG GH                          102
//

If you have problems or comments...

PBIL Back to PBIL home page