(data stored in ACNUC7421 zone)

EMBL: CP000438.PE20

CP000438.PE20        Location/Qualifiers
FT   CDS             21733..22758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00210"
FT                   /product="putative lysin domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14976"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJL6"
FT                   /protein_id="ABJ14976.1"
FT                   /translation="MRKSLVALLLLAASGLAQAQVDLREGHPDRYTVVRGDTLWDISGK
FT                   FLRQPWKWPELWHANPQIQNPHLIYPGDTLSLVYVDGQPRLVLNRGESRGTIKLSPKIR
FT                   STPIAEAIPTIPLDKINSFLLANRIVDDEKTFTSAPYIVAGNAERIVSGTGDRIYARGK
FT                   FADGQPAYGIFRQGKVYIDPKTKEVLGINADDIGGGEVVATEGDVATLALTRTTQEVRL
FT                   GDRLFPTEERAVNSTFMPGEPSREVKGEIIDVPRGVTQIGQFDVVTLNRGQRDGLAEGN
FT                   VLAIYKVGETVRDRVTGESVKIPDERAGLLMVFRTYKKLSYALVLMASRPLSVTDRVQN
FT                   P"
     MRKSLVALLL LAASGLAQAQ VDLREGHPDR YTVVRGDTLW DISGKFLRQP WKWPELWHAN        60
     PQIQNPHLIY PGDTLSLVYV DGQPRLVLNR GESRGTIKLS PKIRSTPIAE AIPTIPLDKI       120
     NSFLLANRIV DDEKTFTSAP YIVAGNAERI VSGTGDRIYA RGKFADGQPA YGIFRQGKVY       180
     IDPKTKEVLG INADDIGGGE VVATEGDVAT LALTRTTQEV RLGDRLFPTE ERAVNSTFMP       240
     GEPSREVKGE IIDVPRGVTQ IGQFDVVTLN RGQRDGLAEG NVLAIYKVGE TVRDRVTGES       300
     VKIPDERAGL LMVFRTYKKL SYALVLMASR PLSVTDRVQN P                           341
//

If you have problems or comments...

PBIL Back to PBIL home page