(data stored in ACNUC7421 zone)

EMBL: CP000438.PE216

CP000438.PE216       Location/Qualifiers
FT   CDS             238918..240351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02690"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15169"
FT                   /db_xref="GOA:A0A0H2ZKF1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF1"
FT                   /protein_id="ABJ15169.1"
FT                   /translation="MNDTPNVREPALRRVLGLGPLLAVAIGLVVSQGVMVLMLQGAGTA
FT                   GLGFIVPLGVAYLLALSYAFSFSELALMIPRAGSLSSYTEVAIGHFPAILATFSGYVVV
FT                   AMFALSAELLLLDLIIGKVYPGALPPMLVAYGVLGLFTLLNLLGIDIFARLQSALALLM
FT                   MIVLLVLGLGAVSSDHASAQTALASGWNPLGVSALALTAMAVWGFVGAEFVCPLVEETR
FT                   RPERNIPRSMILGLSIIFLTIALYCFGALLCIPQAELAGDPLPHFLFANRVFGEYGQLF
FT                   LVIAAITATCSTLNSSLAAIPRMLYGMAQNGQAFPQFKQLSRRARTPWVAVLFVAAITG
FT                   LPILILGQDPDSINLLLLAAALAWLLAYIIAHVDVLALRRRYPHIARPFRTPFYPLPQL
FT                   FGIAGMIYAVVHVSPTPEMTGRIFASAGVVLGVVSLVAVVWIKGVMRKPLFVPEPLETA
FT                   GETAQGKSVALDPLQSPSA"
     MNDTPNVREP ALRRVLGLGP LLAVAIGLVV SQGVMVLMLQ GAGTAGLGFI VPLGVAYLLA        60
     LSYAFSFSEL ALMIPRAGSL SSYTEVAIGH FPAILATFSG YVVVAMFALS AELLLLDLII       120
     GKVYPGALPP MLVAYGVLGL FTLLNLLGID IFARLQSALA LLMMIVLLVL GLGAVSSDHA       180
     SAQTALASGW NPLGVSALAL TAMAVWGFVG AEFVCPLVEE TRRPERNIPR SMILGLSIIF       240
     LTIALYCFGA LLCIPQAELA GDPLPHFLFA NRVFGEYGQL FLVIAAITAT CSTLNSSLAA       300
     IPRMLYGMAQ NGQAFPQFKQ LSRRARTPWV AVLFVAAITG LPILILGQDP DSINLLLLAA       360
     ALAWLLAYII AHVDVLALRR RYPHIARPFR TPFYPLPQLF GIAGMIYAVV HVSPTPEMTG       420
     RIFASAGVVL GVVSLVAVVW IKGVMRKPLF VPEPLETAGE TAQGKSVALD PLQSPSA          477
//

If you have problems or comments...

PBIL Back to PBIL home page