(data stored in ACNUC7421 zone)

EMBL: CP000438.PE218

CP000438.PE218       Location/Qualifiers
FT   CDS             241928..242986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02720"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15171"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN0"
FT                   /protein_id="ABJ15171.1"
FT                   /translation="MYKSLHQYAHVFSRLSLFGLAFAAAAQAQSQSLTVISFGGATKAA
FT                   QEQAYFKPFERSGGGQVVAGEYNGEMAKVKAMVDVGKVSWDVVEVESPELLRGCDEGLF
FT                   ERLDPARFGDPAQFVPGTFSECGVATYVWSMVMAYDSTKLARAPQSWADFWNVREFPGK
FT                   RGLRKGAKYTLEVALLADGVKAEDLYKVLATPEGVSRAFAKLDQLKPNIQWWEAGAQPP
FT                   QWLAAGDVVMSAAYNGRIAAAQKEGVKLAIVWPGSLYDPEYWAVVKGTPNKALAEKFIA
FT                   FVSQPQTQKVFSEQIPYGPVHKGTLALLPKTVQEALPTAPANLEGARAVDAEFWVDHGE
FT                   ELEQRFNAWAAR"
     MYKSLHQYAH VFSRLSLFGL AFAAAAQAQS QSLTVISFGG ATKAAQEQAY FKPFERSGGG        60
     QVVAGEYNGE MAKVKAMVDV GKVSWDVVEV ESPELLRGCD EGLFERLDPA RFGDPAQFVP       120
     GTFSECGVAT YVWSMVMAYD STKLARAPQS WADFWNVREF PGKRGLRKGA KYTLEVALLA       180
     DGVKAEDLYK VLATPEGVSR AFAKLDQLKP NIQWWEAGAQ PPQWLAAGDV VMSAAYNGRI       240
     AAAQKEGVKL AIVWPGSLYD PEYWAVVKGT PNKALAEKFI AFVSQPQTQK VFSEQIPYGP       300
     VHKGTLALLP KTVQEALPTA PANLEGARAV DAEFWVDHGE ELEQRFNAWA AR               352
//

If you have problems or comments...

PBIL Back to PBIL home page