(data stored in ACNUC7421 zone)

EMBL: CP000438.PE230

CP000438.PE230       Location/Qualifiers
FT   CDS             253792..254625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15183"
FT                   /db_xref="GOA:A0A0H2ZJI0"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJI0"
FT                   /protein_id="ABJ15183.1"
FT                   /translation="MKKMMQGAAALIALVGAGESMALEWMSNSVGFRYGQQFTNPNNPD
FT                   KFAKRIYSFTHADGYRYGSNFFNLDVFLSDSRDPRKGTDHGGSEVYAVYRHQLYASRVF
FT                   DRPLGTGLVKDYAFTLGFDASRNNNLASAKKRALVFGPTLKFNGPGVLDLSLLYYREKN
FT                   HFGVPGARHPDHTFDTTYMLNLTWMRPFKVGNRAAKFQGFVNYVGEKGEDYNDKDTAAE
FT                   TLVRTALMVAALPGDKRQPNLWLGVGYEYWHNKFGVDGGTGSRTSTPTLNMEFTF"
     MKKMMQGAAA LIALVGAGES MALEWMSNSV GFRYGQQFTN PNNPDKFAKR IYSFTHADGY        60
     RYGSNFFNLD VFLSDSRDPR KGTDHGGSEV YAVYRHQLYA SRVFDRPLGT GLVKDYAFTL       120
     GFDASRNNNL ASAKKRALVF GPTLKFNGPG VLDLSLLYYR EKNHFGVPGA RHPDHTFDTT       180
     YMLNLTWMRP FKVGNRAAKF QGFVNYVGEK GEDYNDKDTA AETLVRTALM VAALPGDKRQ       240
     PNLWLGVGYE YWHNKFGVDG GTGSRTSTPT LNMEFTF                                277
//

If you have problems or comments...

PBIL Back to PBIL home page