(data stored in ACNUC7421 zone)

EMBL: CP000438.PE234

CP000438.PE234       Location/Qualifiers
FT   CDS             258505..259320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15187"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK34"
FT                   /protein_id="ABJ15187.1"
FT                   /translation="MESRILSLAALTVLELSPPDMVEAAARAGYSHVGLRLVPATVEEH
FT                   HYPLLADAGLRRRTLARLRDSGVRTLDVEILRLRPDTRVGEFAAVLEVGAEFGARYVLV
FT                   AGNDDDERRSADNFAALCDLARPLGLDPHLEFMPWTGIRDLRQAARVVEAAARDNAGLL
FT                   LDAFHFDRSASSLEDLRAIPPARLGYAQLCDVVGPRPTSMDEILRQAREERRFPGDGGL
FT                   DLLALLRALPENLPLSLEVPALDLLARGVDGAERARLAIERTRALLARL"
     MESRILSLAA LTVLELSPPD MVEAAARAGY SHVGLRLVPA TVEEHHYPLL ADAGLRRRTL        60
     ARLRDSGVRT LDVEILRLRP DTRVGEFAAV LEVGAEFGAR YVLVAGNDDD ERRSADNFAA       120
     LCDLARPLGL DPHLEFMPWT GIRDLRQAAR VVEAAARDNA GLLLDAFHFD RSASSLEDLR       180
     AIPPARLGYA QLCDVVGPRP TSMDEILRQA REERRFPGDG GLDLLALLRA LPENLPLSLE       240
     VPALDLLARG VDGAERARLA IERTRALLAR L                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page