(data stored in ACNUC7421 zone)

EMBL: CP000438.PE246

CP000438.PE246       Location/Qualifiers
FT   CDS             complement(272125..272559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03090"
FT                   /product="putative CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15199"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI6"
FT                   /protein_id="ABJ15199.1"
FT                   /translation="MKTVAQLLNAKQNQQVYTIGPDEMVLDALRLMAEKNIGALLVVNH
FT                   GEVVGVVSERDYARKMVLKGRSSIGTPISAIMSAPVVSVDSKQSVDTCMNLMTDRHLRH
FT                   LPVVEDGQLLGLLSIGDLVKAAIAEQAELIQQLEQYIRGD"
     MKTVAQLLNA KQNQQVYTIG PDEMVLDALR LMAEKNIGAL LVVNHGEVVG VVSERDYARK        60
     MVLKGRSSIG TPISAIMSAP VVSVDSKQSV DTCMNLMTDR HLRHLPVVED GQLLGLLSIG       120
     DLVKAAIAEQ AELIQQLEQY IRGD                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page