(data stored in ACNUC7421 zone)

EMBL: CP000438.PE247

CP000438.PE247       Location/Qualifiers
FT   CDS             complement(272724..273365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15200"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="InterPro:IPR037181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG4"
FT                   /protein_id="ABJ15200.1"
FT                   /translation="MNDYIARLREKYDDHFGCAPSIVLDCRDFWRHCVTAPEMAVFGYR
FT                   LESSRRPHHVVITAGMSQARMHFAPYMGSARWSSELICYLDVLGGEDLRHLQWLAGLPF
FT                   HERLALGHGHSVAFGFPLYEHSLLRHFLLLPTPLGEDAALFDGFDLSAHPVDLLWVVPL
FT                   TEQEYQVKVNKHLEGIAEVLNDAGHPLSLDRHRHCYVTGLRPEGFERILH"
     MNDYIARLRE KYDDHFGCAP SIVLDCRDFW RHCVTAPEMA VFGYRLESSR RPHHVVITAG        60
     MSQARMHFAP YMGSARWSSE LICYLDVLGG EDLRHLQWLA GLPFHERLAL GHGHSVAFGF       120
     PLYEHSLLRH FLLLPTPLGE DAALFDGFDL SAHPVDLLWV VPLTEQEYQV KVNKHLEGIA       180
     EVLNDAGHPL SLDRHRHCYV TGLRPEGFER ILH                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page