(data stored in ACNUC7421 zone)

EMBL: CP000438.PE251

CP000438.PE251       Location/Qualifiers
FT   CDS             complement(276153..276839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03150"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15204"
FT                   /db_xref="GOA:A0A0H2ZKM7"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM7"
FT                   /protein_id="ABJ15204.1"
FT                   /translation="MVGSSARRLRLRRTRGRVGLGLVAGLSVLAGMTDAIGFLATGDFV
FT                   SFMSGNTTRLAVSLGEGDFGGLVRLSVALASFVVGNALGVILARFSGRRAAPILVCCAM
FT                   LLALSAVWPFDWNVPALVAAILAMGMLNAVVEQVNGLPIGLTYVTGALSRFGRGLGRWL
FT                   LGERRNGWRVQLVPWSGMCVGAVLGALLEQQLGLAAMAASAALAALLALLALVIPRPWQ
FT                   MDYMVR"
     MVGSSARRLR LRRTRGRVGL GLVAGLSVLA GMTDAIGFLA TGDFVSFMSG NTTRLAVSLG        60
     EGDFGGLVRL SVALASFVVG NALGVILARF SGRRAAPILV CCAMLLALSA VWPFDWNVPA       120
     LVAAILAMGM LNAVVEQVNG LPIGLTYVTG ALSRFGRGLG RWLLGERRNG WRVQLVPWSG       180
     MCVGAVLGAL LEQQLGLAAM AASAALAALL ALLALVIPRP WQMDYMVR                    228
//

If you have problems or comments...

PBIL Back to PBIL home page