(data stored in ACNUC7421 zone)

EMBL: CP000438.PE252

CP000438.PE252       Location/Qualifiers
FT   CDS             complement(277003..277935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15205"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ0"
FT                   /protein_id="ABJ15205.1"
FT                   /translation="MRSWHGVVTKIAKQGKGAVVKNRLGPEELLVPFTVSTLVEVDLDA
FT                   RIYGTDVDDTPWAEGDERKEVLVGTEVELLTDTDTFPTHASQVLSANFRFALDIVKGGL
FT                   SGPVRKGAVLVIYHDFQQEIRRGDSGSAFAEAVVAYARNKLYKPAFAIKADTNYAQLVR
FT                   DLGKVAAESGEQYFIDTILIATHGTAGQLWLGNPHGDSTADVMARRVQGKQFVEPQAFG
FT                   ATLLELFGKELAIALYGCDFAGDEDGEAAALELRIAANARAVYAGKGTVYLNASKEGRS
FT                   TVTCSKAMVVYRTDKIEVLGGNQVPVFDI"
     MRSWHGVVTK IAKQGKGAVV KNRLGPEELL VPFTVSTLVE VDLDARIYGT DVDDTPWAEG        60
     DERKEVLVGT EVELLTDTDT FPTHASQVLS ANFRFALDIV KGGLSGPVRK GAVLVIYHDF       120
     QQEIRRGDSG SAFAEAVVAY ARNKLYKPAF AIKADTNYAQ LVRDLGKVAA ESGEQYFIDT       180
     ILIATHGTAG QLWLGNPHGD STADVMARRV QGKQFVEPQA FGATLLELFG KELAIALYGC       240
     DFAGDEDGEA AALELRIAAN ARAVYAGKGT VYLNASKEGR STVTCSKAMV VYRTDKIEVL       300
     GGNQVPVFDI                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page