(data stored in ACNUC7421 zone)

EMBL: CP000438.PE253

CP000438.PE253       Location/Qualifiers
FT   CDS             278510..279133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03163"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15668"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ8"
FT                   /protein_id="ABJ15668.1"
FT                   /translation="MSSPIIRHHLLHRLRDRQERFDVIFSEQKVAHMAAFFLASAEGPL
FT                   PHLTLIKLLYLADRESMARFDVPMSDDRAVSMPHGPVLSSTLDLIKGRLRSEVWSAWIS
FT                   PLVDHEVRLVHDVENWDDLDELSRSDRSILESVWQEFGHMTKYQLRDYTHHHIGEWHDP
FT                   HGSSRDIDPKDTFMALGQSEELAEIKARDLAERRRHGRKLSEFI"
     MSSPIIRHHL LHRLRDRQER FDVIFSEQKV AHMAAFFLAS AEGPLPHLTL IKLLYLADRE        60
     SMARFDVPMS DDRAVSMPHG PVLSSTLDLI KGRLRSEVWS AWISPLVDHE VRLVHDVENW       120
     DDLDELSRSD RSILESVWQE FGHMTKYQLR DYTHHHIGEW HDPHGSSRDI DPKDTFMALG       180
     QSEELAEIKA RDLAERRRHG RKLSEFI                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page