(data stored in ACNUC7421 zone)

EMBL: CP000438.PE254

CP000438.PE254       Location/Qualifiers
FT   CDS             279133..279531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03166"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLW4"
FT                   /protein_id="ABJ15667.1"
FT                   /translation="MPGNVFQKGTLLIPTGGANHLHFVMNDPVYCPVLGYDAVLLVNIS
FT                   TVYPDKYFDQSCILKKGCHPFVLRDSWVVYREAGPFNLARLEQGVAQKSIKTHQPINAG
FT                   DFTRIRAGFDISPDVKIKVERFMRQHKI"
     MPGNVFQKGT LLIPTGGANH LHFVMNDPVY CPVLGYDAVL LVNISTVYPD KYFDQSCILK        60
     KGCHPFVLRD SWVVYREAGP FNLARLEQGV AQKSIKTHQP INAGDFTRIR AGFDISPDVK       120
     IKVERFMRQH KI                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page