(data stored in ACNUC7421 zone)

EMBL: CP000438.PE255

CP000438.PE255       Location/Qualifiers
FT   CDS             complement(279718..280557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15206"
FT                   /db_xref="GOA:A0A0H2ZKU6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU6"
FT                   /protein_id="ABJ15206.1"
FT                   /translation="MQARTGISERRACQLIGLSRSVLRYQPRASVQNELQAQLVELAQE
FT                   RRRFGYRRLHILLRRAGVQVNHKRIYRLYRAAGLMVKRRRRRHGVAVERERLSLPSAPN
FT                   QVWSMDFVFDALSTGRRIKCLTVVDDFTKESVGILVEHGISGFRVTRALDEMARFRGYP
FT                   KASRTDQGPEFTGKALDQWAYQRDIKLKLIQPGKPTQNAFIKSFNGKFRDECLSEHWFY
FT                   SLAEARIRIAAWRRDYNEHRPHSAIGNLTPAEFAASWRTRQQQLKQEKLISTPGLTN"
     MQARTGISER RACQLIGLSR SVLRYQPRAS VQNELQAQLV ELAQERRRFG YRRLHILLRR        60
     AGVQVNHKRI YRLYRAAGLM VKRRRRRHGV AVERERLSLP SAPNQVWSMD FVFDALSTGR       120
     RIKCLTVVDD FTKESVGILV EHGISGFRVT RALDEMARFR GYPKASRTDQ GPEFTGKALD       180
     QWAYQRDIKL KLIQPGKPTQ NAFIKSFNGK FRDECLSEHW FYSLAEARIR IAAWRRDYNE       240
     HRPHSAIGNL TPAEFAASWR TRQQQLKQEK LISTPGLTN                              279
//

If you have problems or comments...

PBIL Back to PBIL home page