(data stored in ACNUC7421 zone)

EMBL: CP000438.PE257

CP000438.PE257       Location/Qualifiers
FT   CDS             complement(280973..282415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15208"
FT                   /db_xref="InterPro:IPR021531"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJP5"
FT                   /protein_id="ABJ15208.1"
FT                   /translation="MSADAYHAPKTSPRLETLDVLSIGMSLDVFRQGQVWKALQEQNAV
FT                   QAEALHVGSILPMDPKKYPTSADDKDMAYEKRQADALELGLKNFLEKWPIPTVTVVRSW
FT                   DPSTPNLRFTPEETRESLSVKVNDLRVPAGLHWHRIANLQDGIICNDTPEGVLEALFSL
FT                   FERNPDLPAVLVYANEGFNMAGSLSSRDVPLKSLGGGSGPRVPGTLTDTMVALIVGRPE
FT                   RVDWLRQFAPYTKVNENRIDPEFRGWGWRKPPVEFRPTPFIPQPWTERALEQWDALPVL
FT                   ARLHRPVSVPLTRPDTGERLKREALTAQLAAAWKTASAGLRPAPARLFYDGGLNATPLA
FT                   ELTPALGAAQSSLDLLDSRESYDLTQRLGDTGAASPFVGIALATMASYLNGDSSMVMPL
FT                   RRKDQATLIGISSPTPGKKPAHDPFGVDLLPQTASGDGPPPSADPVAPASRLTTRLPPG
FT                   EDYALEEFLSSLKPSTDWQDDL"
     MSADAYHAPK TSPRLETLDV LSIGMSLDVF RQGQVWKALQ EQNAVQAEAL HVGSILPMDP        60
     KKYPTSADDK DMAYEKRQAD ALELGLKNFL EKWPIPTVTV VRSWDPSTPN LRFTPEETRE       120
     SLSVKVNDLR VPAGLHWHRI ANLQDGIICN DTPEGVLEAL FSLFERNPDL PAVLVYANEG       180
     FNMAGSLSSR DVPLKSLGGG SGPRVPGTLT DTMVALIVGR PERVDWLRQF APYTKVNENR       240
     IDPEFRGWGW RKPPVEFRPT PFIPQPWTER ALEQWDALPV LARLHRPVSV PLTRPDTGER       300
     LKREALTAQL AAAWKTASAG LRPAPARLFY DGGLNATPLA ELTPALGAAQ SSLDLLDSRE       360
     SYDLTQRLGD TGAASPFVGI ALATMASYLN GDSSMVMPLR RKDQATLIGI SSPTPGKKPA       420
     HDPFGVDLLP QTASGDGPPP SADPVAPASR LTTRLPPGED YALEEFLSSL KPSTDWQDDL       480
//

If you have problems or comments...

PBIL Back to PBIL home page