(data stored in ACNUC7421 zone)

EMBL: CP000438.PE258

CP000438.PE258       Location/Qualifiers
FT   CDS             complement(282565..284715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15209"
FT                   /db_xref="InterPro:IPR021692"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN3"
FT                   /protein_id="ABJ15209.1"
FT                   /translation="MNDRVRSRTIVSAQSITLPKGGDVHLVPPPPKPCVTIVVHGVNDL
FT                   AGCYERIERGLCQGLNERLDMPPTLPGGQANPGYLTPAGYSLPADDEGKAENPDAVYYR
FT                   RKFASGAGGAAVRSVVVPFYWGFREEEQYINKTAAHGEWLDRNGNRLDKSGTKEGGQFV
FT                   NATTNLPDMWGQGFNGKLFGFISLDWFGGTMTHPLFSAAGRKYMVLAAMRLAMLIKIIR
FT                   KRYPDDTINVVGHSQGTLLTLLAHAFLKDDGVAPADGVIMLNSPYGLFEPLNEKLQGWS
FT                   SQQTREARLATLKGILEFICGRRHPVPALSSVALRNCQGYGAIGGPGWVGGLGCQTTID
FT                   GERLSFDERDNRGSVYLYFTPQDQTVGLANVQGIGWRGIAEQVKGLPGRTGLPQGFHQR
FT                   IFTVRKRNGEKEKIGGHAPPHVYPLLLAGEKTWEDTGLGGKDRFGRANFDQGDSVLLTA
FT                   PRLPLPTEARFDFDGTVTAPGENSASGVYQVRDTLDPIDAAIGVSNGGWKEKDSGHAVA
FT                   QQVDTALAYRYGRDTRSVERALNEGKELARQTHVFSARELGTGMVLVTRAETPYEARLR
FT                   LQTAEGHLEPLSFHSAIPNNPEHNRRVLAYDLAIGAGDSVDDVVFYQYLCRVADWRLDW
FT                   KAKDKGLNGQANDEIHIPSEEVQALYHAEEPKNSELIDATVVYRKSGKLPVTVGDSLPS
FT                   LVATQTIEDRYYSRPVRFGGAS"
     MNDRVRSRTI VSAQSITLPK GGDVHLVPPP PKPCVTIVVH GVNDLAGCYE RIERGLCQGL        60
     NERLDMPPTL PGGQANPGYL TPAGYSLPAD DEGKAENPDA VYYRRKFASG AGGAAVRSVV       120
     VPFYWGFREE EQYINKTAAH GEWLDRNGNR LDKSGTKEGG QFVNATTNLP DMWGQGFNGK       180
     LFGFISLDWF GGTMTHPLFS AAGRKYMVLA AMRLAMLIKI IRKRYPDDTI NVVGHSQGTL       240
     LTLLAHAFLK DDGVAPADGV IMLNSPYGLF EPLNEKLQGW SSQQTREARL ATLKGILEFI       300
     CGRRHPVPAL SSVALRNCQG YGAIGGPGWV GGLGCQTTID GERLSFDERD NRGSVYLYFT       360
     PQDQTVGLAN VQGIGWRGIA EQVKGLPGRT GLPQGFHQRI FTVRKRNGEK EKIGGHAPPH       420
     VYPLLLAGEK TWEDTGLGGK DRFGRANFDQ GDSVLLTAPR LPLPTEARFD FDGTVTAPGE       480
     NSASGVYQVR DTLDPIDAAI GVSNGGWKEK DSGHAVAQQV DTALAYRYGR DTRSVERALN       540
     EGKELARQTH VFSARELGTG MVLVTRAETP YEARLRLQTA EGHLEPLSFH SAIPNNPEHN       600
     RRVLAYDLAI GAGDSVDDVV FYQYLCRVAD WRLDWKAKDK GLNGQANDEI HIPSEEVQAL       660
     YHAEEPKNSE LIDATVVYRK SGKLPVTVGD SLPSLVATQT IEDRYYSRPV RFGGAS           716
//

If you have problems or comments...

PBIL Back to PBIL home page