(data stored in ACNUC7421 zone)

EMBL: CP000438.PE260

CP000438.PE260       Location/Qualifiers
FT   CDS             complement(285213..288272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15211"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV2"
FT                   /protein_id="ABJ15211.1"
FT                   /translation="MRQRDLKFTFVVGEGKLAFDVVEFELEEALCEPFRLNLKLASDKN
FT                   AIDFKQVLDQPGTFTLWQDGRPARYVHGIVSHFTQGSSGFRRTRYELLLEPQLARLELC
FT                   CNWRIFQEKSVPEILQALLKEHRVLDYEQRIYHEHLPREYCVQAGDSDHYLHDRLAFEE
FT                   GLVYYFRFDEHRHTLVCSDRLYVQERIAGGPVLFSAQPEGDNPQPVLHSFRYSENVRTA
FT                   RQTQRDYSFKRPTYDQEHHLAGEALEHQDSSYERYDYPGRYKQSGAGRPFSESRLRGHR
FT                   RDARVASVSGDDPRLIPGHAFALEGHPRADFNAWWRPVRVVHRGTQYAGQEEESADAPL
FT                   GVSYDLRAELVPEDVEWRPAPLPRPRIDGPQIATVVGPAGEEIHCDEWGRVKVQFPWDR
FT                   EGRHDEFSTCWIRVAQNWAGADWGNMAIPRIGQEVIVDYLDGDCDQPIVTGRTYRATNR
FT                   PPYALPDHKILSTIKSKEYKGSRANELRIDDTTAQISAALMSDHGASALHLGYLTHPRP
FT                   EGGKPRGEGFELRTDEHGAVRAARGLLLSTEEQLRAGAGHLDRGVVVQVLEAALELARE
FT                   LGDYAGEHQGVGHDAAPQQTLQEAVRDLGHGANDESGKSNGGKPAIALSGPAGIAAATP
FT                   TSLTLAAGEHVDSVARQNQQVTAGQKVVINAGSDIGLFAQGGELRQITHQGPMLLQAQK
FT                   NDIRLEAEQSVEVSASQQHVLVTAKEHITLMCGGAYLTLKGGNIELGMPGNFVVKAAKH
FT                   SHVGAASLEAELPQFEVGETQRRFVLKQLDGQTAMPNVPYTITMANGEVIEGVTDAEGA
FT                   TQLLQKDAMNIAKVDMKHTRSPASAVAGIAAAVGAAVAVGKLLSGPDAEAGRALSEGEI
FT                   SLAKDVFGDSIDYSTVRLRDEDYVPWQGKDYVMAPNGHIYFGEELRGVADWSLESLQRQ
FT                   GLFIHEMTHVWQHQHGVNVLLVGAYQQARQFLLGDQYAYRLEPGKTLKDYNIEQQGDIV
FT                   RDYFLEKNEFGEASANSRFAGVLKNFPTGY"
     MRQRDLKFTF VVGEGKLAFD VVEFELEEAL CEPFRLNLKL ASDKNAIDFK QVLDQPGTFT        60
     LWQDGRPARY VHGIVSHFTQ GSSGFRRTRY ELLLEPQLAR LELCCNWRIF QEKSVPEILQ       120
     ALLKEHRVLD YEQRIYHEHL PREYCVQAGD SDHYLHDRLA FEEGLVYYFR FDEHRHTLVC       180
     SDRLYVQERI AGGPVLFSAQ PEGDNPQPVL HSFRYSENVR TARQTQRDYS FKRPTYDQEH       240
     HLAGEALEHQ DSSYERYDYP GRYKQSGAGR PFSESRLRGH RRDARVASVS GDDPRLIPGH       300
     AFALEGHPRA DFNAWWRPVR VVHRGTQYAG QEEESADAPL GVSYDLRAEL VPEDVEWRPA       360
     PLPRPRIDGP QIATVVGPAG EEIHCDEWGR VKVQFPWDRE GRHDEFSTCW IRVAQNWAGA       420
     DWGNMAIPRI GQEVIVDYLD GDCDQPIVTG RTYRATNRPP YALPDHKILS TIKSKEYKGS       480
     RANELRIDDT TAQISAALMS DHGASALHLG YLTHPRPEGG KPRGEGFELR TDEHGAVRAA       540
     RGLLLSTEEQ LRAGAGHLDR GVVVQVLEAA LELARELGDY AGEHQGVGHD AAPQQTLQEA       600
     VRDLGHGAND ESGKSNGGKP AIALSGPAGI AAATPTSLTL AAGEHVDSVA RQNQQVTAGQ       660
     KVVINAGSDI GLFAQGGELR QITHQGPMLL QAQKNDIRLE AEQSVEVSAS QQHVLVTAKE       720
     HITLMCGGAY LTLKGGNIEL GMPGNFVVKA AKHSHVGAAS LEAELPQFEV GETQRRFVLK       780
     QLDGQTAMPN VPYTITMANG EVIEGVTDAE GATQLLQKDA MNIAKVDMKH TRSPASAVAG       840
     IAAAVGAAVA VGKLLSGPDA EAGRALSEGE ISLAKDVFGD SIDYSTVRLR DEDYVPWQGK       900
     DYVMAPNGHI YFGEELRGVA DWSLESLQRQ GLFIHEMTHV WQHQHGVNVL LVGAYQQARQ       960
     FLLGDQYAYR LEPGKTLKDY NIEQQGDIVR DYFLEKNEFG EASANSRFAG VLKNFPTGY       1019
//

If you have problems or comments...

PBIL Back to PBIL home page