(data stored in ACNUC7421 zone)

EMBL: CP000438.PE263

CP000438.PE263       Location/Qualifiers
FT   CDS             293187..293936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03265"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15670"
FT                   /db_xref="InterPro:IPR025449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL66"
FT                   /protein_id="ABJ15670.1"
FT                   /translation="MAGIFDRIAGASGADETELTAEPMALDDGMDGEQPAMSANIQVDE
FT                   RRTPQRVREAVQEMLKYGLLEESHKPNLYRSALTNIEVVDRILEPLDLAMGVDEVRGLV
FT                   FVTVRQGEVAEQDDWSHPLVRRQRLNLEQSLLIAILRQHFIAYEQESGTGASQALVAVD
FT                   ELIPQLQVYLGELGSEAKERNRIITLLDQLKGHGLVSALDAHDRVIIRPIITHLANPEN
FT                   LQALVVWLREQVEGAVTPAAGGEEDEA"
     MAGIFDRIAG ASGADETELT AEPMALDDGM DGEQPAMSAN IQVDERRTPQ RVREAVQEML        60
     KYGLLEESHK PNLYRSALTN IEVVDRILEP LDLAMGVDEV RGLVFVTVRQ GEVAEQDDWS       120
     HPLVRRQRLN LEQSLLIAIL RQHFIAYEQE SGTGASQALV AVDELIPQLQ VYLGELGSEA       180
     KERNRIITLL DQLKGHGLVS ALDAHDRVII RPIITHLANP ENLQALVVWL REQVEGAVTP       240
     AAGGEEDEA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page