(data stored in ACNUC7421 zone)

EMBL: CP000438.PE264

CP000438.PE264       Location/Qualifiers
FT   CDS             294101..297238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03270"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN9"
FT                   /protein_id="ABJ15214.1"
FT                   /translation="MTLLCANPRYNLASTGGHESDRDLVSYVRGVTGPGDGGVEQSHIA
FT                   RQGKTVTAIAATLERDGAQVRLGAVLWFEGTSSSASDLKKLWLLSESPEQTLEHWLSQH
FT                   HAGGMRALRQMEKDGMGIWPYPSKKAFLARLRDYFEVGENAFTLLNRAAGLKQLNSIDE
FT                   IFRELVLDDRSAFERAAEVASSFDDLTDIHRELETARKQQRSLQPVADGWERYRALQEQ
FT                   LQDKQALEGILPVWFAEQGYRLWLAETNRLEKEHKQAELDQAQCRSQLEIQKGVVDQHR
FT                   QRYLRVGGAGIDQLRGRIADWVRECDKRRLKAEQYQRLAKGLGLADELSAAALEENQQQ
FT                   IAARLEILAQQTTDARQKAFDAGLVQQELNGRLQSLQQERAEVERRPGSNLPGHFHAFR
FT                   GDLAQELGVDESALPFVAELVQVKPEELAWRGAIERAIGSHRLRILVPQGSSQAALRWV
FT                   NQRHNRLHVRLLEVKEPSSRPVFFDDGFTRKLTFKEHPYREAVKALLADNDRHCVESTE
FT                   QLRHTPHAMTAQGLMSGKERFFDKQDQKRLDEDWLTGFDNRDRLAFLAEQIREVNEQLV
FT                   PAKLALDAAQGDVGQLESQASLLQRIEELQFDDIDRPGAERQLQSLRTQLDTLTRPDSN
FT                   LAVIKAELDQAEALRESLDQQLQRLIEQCVQLKTQFDQAASATRKAYRGAEKGLSDTQR
FT                   ELAQAHFPILSTDDLGDIDELERKHTRELQGQLKTLGEKLGDQKTELAKRMSDALKADT
FT                   GALAEVGRELVDVPRYLERLRVLTEEALPEKLKRFLEYLNRSSDDGVTQLLSYIDHEVS
FT                   MIEERLDDLNSTMQRVDFQPGRYLRLVAKKVIHESLRTLQHAQRQLNSARFIDDEGESH
FT                   YKALQALVGLLKDACEHSRNQGAKALLDPRFRLEFAVSVIDREGNNLIETRTGSQGGSG
FT                   GEKEIIASYVLTASLSYALCPDGSSRPLFGTIVLDEAFSRSSHAVAGRIIAALREFGLH
FT                   AVFITPNKEMRLLRHHTRSAVVVHRRGVESSLVSLSWEALDEHHQQRIRAMHEVAH"
     MTLLCANPRY NLASTGGHES DRDLVSYVRG VTGPGDGGVE QSHIARQGKT VTAIAATLER        60
     DGAQVRLGAV LWFEGTSSSA SDLKKLWLLS ESPEQTLEHW LSQHHAGGMR ALRQMEKDGM       120
     GIWPYPSKKA FLARLRDYFE VGENAFTLLN RAAGLKQLNS IDEIFRELVL DDRSAFERAA       180
     EVASSFDDLT DIHRELETAR KQQRSLQPVA DGWERYRALQ EQLQDKQALE GILPVWFAEQ       240
     GYRLWLAETN RLEKEHKQAE LDQAQCRSQL EIQKGVVDQH RQRYLRVGGA GIDQLRGRIA       300
     DWVRECDKRR LKAEQYQRLA KGLGLADELS AAALEENQQQ IAARLEILAQ QTTDARQKAF       360
     DAGLVQQELN GRLQSLQQER AEVERRPGSN LPGHFHAFRG DLAQELGVDE SALPFVAELV       420
     QVKPEELAWR GAIERAIGSH RLRILVPQGS SQAALRWVNQ RHNRLHVRLL EVKEPSSRPV       480
     FFDDGFTRKL TFKEHPYREA VKALLADNDR HCVESTEQLR HTPHAMTAQG LMSGKERFFD       540
     KQDQKRLDED WLTGFDNRDR LAFLAEQIRE VNEQLVPAKL ALDAAQGDVG QLESQASLLQ       600
     RIEELQFDDI DRPGAERQLQ SLRTQLDTLT RPDSNLAVIK AELDQAEALR ESLDQQLQRL       660
     IEQCVQLKTQ FDQAASATRK AYRGAEKGLS DTQRELAQAH FPILSTDDLG DIDELERKHT       720
     RELQGQLKTL GEKLGDQKTE LAKRMSDALK ADTGALAEVG RELVDVPRYL ERLRVLTEEA       780
     LPEKLKRFLE YLNRSSDDGV TQLLSYIDHE VSMIEERLDD LNSTMQRVDF QPGRYLRLVA       840
     KKVIHESLRT LQHAQRQLNS ARFIDDEGES HYKALQALVG LLKDACEHSR NQGAKALLDP       900
     RFRLEFAVSV IDREGNNLIE TRTGSQGGSG GEKEIIASYV LTASLSYALC PDGSSRPLFG       960
     TIVLDEAFSR SSHAVAGRII AALREFGLHA VFITPNKEMR LLRHHTRSAV VVHRRGVESS      1020
     LVSLSWEALD EHHQQRIRAM HEVAH                                            1045
//

If you have problems or comments...

PBIL Back to PBIL home page