(data stored in ACNUC7421 zone)

EMBL: CP000438.PE265

CP000438.PE265       Location/Qualifiers
FT   CDS             297222..298367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03285"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15669"
FT                   /db_xref="InterPro:IPR014544"
FT                   /db_xref="InterPro:IPR024534"
FT                   /db_xref="InterPro:IPR024537"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZM47"
FT                   /protein_id="ABJ15669.1"
FT                   /translation="MKSPTDIGRNLARQWQRSSVRLERLLNPGSWPQSLNIGKPSARLF
FT                   TDNIQAVLRHVENWRSVNVGKVDWEPVSYRAGLAPISLPMRWHLRSPSEWIAASDDPRV
FT                   SQEYAQLEYLVEQVDSAFHTLLVAQRSLWLTRTPEEVVATAQLATQLAPGCAQGRPLRL
FT                   LAEHGVDTKFFERNATLLTKLLDERFEGAASEQGLTTFLDAFEESSHWVLVVPLQPGLL
FT                   PFKRLRLTTSELAETPLPGSRLLVVENEQCVHLLPETLPDTLAVLGAGLDLHWLASAHL
FT                   AGKQIGYWGDMDTWGLLMLARARLHQPAVEALLMEQELFEQHSQGNTVVEPAKALESAP
FT                   PGLLADEADFYRYLLVQERGRLEQEYLPKAQVELAIRKWAR"
     MKSPTDIGRN LARQWQRSSV RLERLLNPGS WPQSLNIGKP SARLFTDNIQ AVLRHVENWR        60
     SVNVGKVDWE PVSYRAGLAP ISLPMRWHLR SPSEWIAASD DPRVSQEYAQ LEYLVEQVDS       120
     AFHTLLVAQR SLWLTRTPEE VVATAQLATQ LAPGCAQGRP LRLLAEHGVD TKFFERNATL       180
     LTKLLDERFE GAASEQGLTT FLDAFEESSH WVLVVPLQPG LLPFKRLRLT TSELAETPLP       240
     GSRLLVVENE QCVHLLPETL PDTLAVLGAG LDLHWLASAH LAGKQIGYWG DMDTWGLLML       300
     ARARLHQPAV EALLMEQELF EQHSQGNTVV EPAKALESAP PGLLADEADF YRYLLVQERG       360
     RLEQEYLPKA QVELAIRKWA R                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page