(data stored in ACNUC7421 zone)

EMBL: CP000438.PE267

CP000438.PE267       Location/Qualifiers
FT   CDS             298872..299717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15216"
FT                   /db_xref="GOA:A0A0H2ZKV6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV6"
FT                   /protein_id="ABJ15216.1"
FT                   /translation="MIDQLSEQESVEVVCSAFDVARSCYYVHRLRRRRVDARRVALRSQ
FT                   VNQLFSQSRGSAGSRSILGMLREEGVTIGRFRVRRLMRELGLVSKQPGSHAYKQATVER
FT                   PDIPNRLNREFATEHPNQVWCGDITYVWAQGRWHYLAAVLDLLIGWAFSAKPDAELVIK
FT                   ALDMAYEQRGRPQQVLFHSVQGSQYASRLFRQRLWRYRMQQSMSRRGNCWDNSPMERLF
FT                   RSLKSEWVPSTGYLTAQEAQRDISHYLMHRYNWIRPHQFNDGLPPAVAEEKLNPLSGMG
FT                   "
     MIDQLSEQES VEVVCSAFDV ARSCYYVHRL RRRRVDARRV ALRSQVNQLF SQSRGSAGSR        60
     SILGMLREEG VTIGRFRVRR LMRELGLVSK QPGSHAYKQA TVERPDIPNR LNREFATEHP       120
     NQVWCGDITY VWAQGRWHYL AAVLDLLIGW AFSAKPDAEL VIKALDMAYE QRGRPQQVLF       180
     HSVQGSQYAS RLFRQRLWRY RMQQSMSRRG NCWDNSPMER LFRSLKSEWV PSTGYLTAQE       240
     AQRDISHYLM HRYNWIRPHQ FNDGLPPAVA EEKLNPLSGM G                           281
//

If you have problems or comments...

PBIL Back to PBIL home page