(data stored in ACNUC7421 zone)

EMBL: CP000438.PE268

CP000438.PE268       Location/Qualifiers
FT   CDS             300333..301931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15217"
FT                   /db_xref="GOA:A0A0H2ZK75"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK75"
FT                   /protein_id="ABJ15217.1"
FT                   /translation="MACSHKKPGFLVPALIETEHLSNMSFLRDFRRVVARAAFRLLADR
FT                   LPKPRSTKESLHILVPRWDAKLGDSIVSSFFFREARRLNARVTVLTVVELAQAHTQDFG
FT                   VDQVVITNANPGVLELRRLAQQLGQVDVVVHLVGRIQPAEILFLRLLRPTRVYSLDDRL
FT                   RCVNRKFGETTAGLDMAERYRRVLMDLGASMVDRKYIVPLPDTMPNPTLAPKILLNPYA
FT                   SRPDKCLAFDRSVSLLHAIADAYPTRSVGILCSPATQEDALRMEVAVARSNVHVVHGLA
FT                   SPKDVAGYIRCAQVVVSVDTAIVHMAVGLETRLVAIYPDVDGQANPWLPPPSPLTRVVY
FT                   SQQHPGQIRRTGKKDMNAFSLEALLDNLHELLATTPETEQLHSIRARKVPGLGAANGTL
FT                   ARQLPLISQDFPEVADCHPGTINLELECPLEVTQPDHRTAPLAWTPSGRTTEVFDLVRI
FT                   ELEFGPLPTRVPAWLYVAHGSPHRCTPTVHEVIARQLNLSEVRECQVHLRASAVTLARP
FT                   DQQTASISRSLSPSQ"
     MACSHKKPGF LVPALIETEH LSNMSFLRDF RRVVARAAFR LLADRLPKPR STKESLHILV        60
     PRWDAKLGDS IVSSFFFREA RRLNARVTVL TVVELAQAHT QDFGVDQVVI TNANPGVLEL       120
     RRLAQQLGQV DVVVHLVGRI QPAEILFLRL LRPTRVYSLD DRLRCVNRKF GETTAGLDMA       180
     ERYRRVLMDL GASMVDRKYI VPLPDTMPNP TLAPKILLNP YASRPDKCLA FDRSVSLLHA       240
     IADAYPTRSV GILCSPATQE DALRMEVAVA RSNVHVVHGL ASPKDVAGYI RCAQVVVSVD       300
     TAIVHMAVGL ETRLVAIYPD VDGQANPWLP PPSPLTRVVY SQQHPGQIRR TGKKDMNAFS       360
     LEALLDNLHE LLATTPETEQ LHSIRARKVP GLGAANGTLA RQLPLISQDF PEVADCHPGT       420
     INLELECPLE VTQPDHRTAP LAWTPSGRTT EVFDLVRIEL EFGPLPTRVP AWLYVAHGSP       480
     HRCTPTVHEV IARQLNLSEV RECQVHLRAS AVTLARPDQQ TASISRSLSP SQ               532
//

If you have problems or comments...

PBIL Back to PBIL home page