(data stored in ACNUC7421 zone)

EMBL: CP000438.PE269

CP000438.PE269       Location/Qualifiers
FT   CDS             complement(302683..303804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15218"
FT                   /db_xref="InterPro:IPR028944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJQ3"
FT                   /protein_id="ABJ15218.1"
FT                   /translation="MTPGKSLPWSEVLTRPVDVQLTMFRQASAQPCADDVKTGFRAFSA
FT                   DLFARGLISMAEYVSIFGGTVLHCLTPAESGLFRDMDTGADASALAGVYSRAKYGSVGD
FT                   IQYLARQLIDYLCGELDRPDSQWSCLFRNAKACGDNVVMMTTGWRNVPSTANVLYEIVV
FT                   EEVNVKLAHMALPTIINVKLPRIAPPCEDYANLSTEERERVNLVQDHVIPAENFYRWSG
FT                   VHVIFGDDVLVTGSTADKVLYESMRSGAKSFRAIYPVAIDPRVALGDASVEDRLNSVVV
FT                   EQRLDDTVAELLSARDYQPILRTLRLLFGEGNRESLAAFLPKVPAPTWLRLYKSALGNE
FT                   FLGQPQCAPSLVLLREYLTNAGLLSTNGRAIHP"
     MTPGKSLPWS EVLTRPVDVQ LTMFRQASAQ PCADDVKTGF RAFSADLFAR GLISMAEYVS        60
     IFGGTVLHCL TPAESGLFRD MDTGADASAL AGVYSRAKYG SVGDIQYLAR QLIDYLCGEL       120
     DRPDSQWSCL FRNAKACGDN VVMMTTGWRN VPSTANVLYE IVVEEVNVKL AHMALPTIIN       180
     VKLPRIAPPC EDYANLSTEE RERVNLVQDH VIPAENFYRW SGVHVIFGDD VLVTGSTADK       240
     VLYESMRSGA KSFRAIYPVA IDPRVALGDA SVEDRLNSVV VEQRLDDTVA ELLSARDYQP       300
     ILRTLRLLFG EGNRESLAAF LPKVPAPTWL RLYKSALGNE FLGQPQCAPS LVLLREYLTN       360
     AGLLSTNGRA IHP                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page