(data stored in ACNUC7421 zone)

EMBL: CP000438.PE270

CP000438.PE270       Location/Qualifiers
FT   CDS             complement(303810..304676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15219"
FT                   /db_xref="GOA:A0A0H2ZKP4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP4"
FT                   /protein_id="ABJ15219.1"
FT                   /translation="MIDSHSHTFYSKHATGTVDELVRASIAAGVTILTLTDHAPFPVDT
FT                   DNRLLASELDRYFADIERARNSYQEQITILCGLELDYMPGTDAFNRELLTCYPMDFVIG
FT                   SIHYVEVPDETMVKVWELPRLAGQAFLDRYFANLEGLLDSGLFDAVGHADTLLRGVPED
FT                   IFLRRFEPLLAPLARSGIAFELNASGLRKSSLDPATGREVQGFWSYPSRELVAQLIAHE
FT                   VPFTVGSDTHDPSDAGAGIAELLTALQPLGLQRISYYERRRRIDVALDTLALPGAPATL
FT                   TEGLERP"
     MIDSHSHTFY SKHATGTVDE LVRASIAAGV TILTLTDHAP FPVDTDNRLL ASELDRYFAD        60
     IERARNSYQE QITILCGLEL DYMPGTDAFN RELLTCYPMD FVIGSIHYVE VPDETMVKVW       120
     ELPRLAGQAF LDRYFANLEG LLDSGLFDAV GHADTLLRGV PEDIFLRRFE PLLAPLARSG       180
     IAFELNASGL RKSSLDPATG REVQGFWSYP SRELVAQLIA HEVPFTVGSD THDPSDAGAG       240
     IAELLTALQP LGLQRISYYE RRRRIDVALD TLALPGAPAT LTEGLERP                    288
//

If you have problems or comments...

PBIL Back to PBIL home page