(data stored in ACNUC7421 zone)

EMBL: CP000438.PE271

CP000438.PE271       Location/Qualifiers
FT   CDS             complement(304673..305599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15220"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK0"
FT                   /protein_id="ABJ15220.1"
FT                   /translation="MELSTLARENLARLINAPEVKRISISGEGEPLNNVKVFHEILGLS
FT                   EGGKCFEFITSGFYPHDKMADFYDTTNRIVLGNGDVCNIRLSADSHHIEQVKWRAHGFS
FT                   LDYLRSRCPSGLSFSFRSIDTDRDFTREYLKSELARWGVEATIEPRSVLEDVLVAGGEC
FT                   FGIDYKNLVHPAPGTAPGYLDMLGYIEAIESKVNKRFTFGSLNKPPQANGLDVTVKPNG
FT                   DVYLYGIENQRLGNIHFDRVDWQRLVAHVRETPLTRALYTQPLTELLARLEKTDLLRSI
FT                   IAKANNPYWLVKELAGHAGLLEQWEAA"
     MELSTLAREN LARLINAPEV KRISISGEGE PLNNVKVFHE ILGLSEGGKC FEFITSGFYP        60
     HDKMADFYDT TNRIVLGNGD VCNIRLSADS HHIEQVKWRA HGFSLDYLRS RCPSGLSFSF       120
     RSIDTDRDFT REYLKSELAR WGVEATIEPR SVLEDVLVAG GECFGIDYKN LVHPAPGTAP       180
     GYLDMLGYIE AIESKVNKRF TFGSLNKPPQ ANGLDVTVKP NGDVYLYGIE NQRLGNIHFD       240
     RVDWQRLVAH VRETPLTRAL YTQPLTELLA RLEKTDLLRS IIAKANNPYW LVKELAGHAG       300
     LLEQWEAA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page