(data stored in ACNUC7421 zone)

EMBL: CP000438.PE272

CP000438.PE272       Location/Qualifiers
FT   CDS             complement(305950..306903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15221"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW0"
FT                   /protein_id="ABJ15221.1"
FT                   /translation="MAELNVIFDVPEAIAEGLKNGVYERIGGVIRRVADKQIVMWLQEG
FT                   VLLERDTAEQLLKQGAEHVQLLRQQAEQLQMLGVQQQLIMGLEVANLAVSVAGFALTLY
FT                   KLQGIENQLRHMDGKLDDIRQGVEWLDVRQMISRLAPLHAALQHVREAGLYRNAAMMQQ
FT                   QLGIANSQLAESQSYFGGLLQHVSERSFEYLQPGEFAAAYRGWVMSAQGRLQVLARLGE
FT                   MDLAAHLANEFKERHAGFGQRLQQSLKNPALRLMAGQQGETNHARLLSIAEQAVGAHEI
FT                   IRGNVMQLEFMRDEQLDLPILNSPAGYQGLAFCRVG"
     MAELNVIFDV PEAIAEGLKN GVYERIGGVI RRVADKQIVM WLQEGVLLER DTAEQLLKQG        60
     AEHVQLLRQQ AEQLQMLGVQ QQLIMGLEVA NLAVSVAGFA LTLYKLQGIE NQLRHMDGKL       120
     DDIRQGVEWL DVRQMISRLA PLHAALQHVR EAGLYRNAAM MQQQLGIANS QLAESQSYFG       180
     GLLQHVSERS FEYLQPGEFA AAYRGWVMSA QGRLQVLARL GEMDLAAHLA NEFKERHAGF       240
     GQRLQQSLKN PALRLMAGQQ GETNHARLLS IAEQAVGAHE IIRGNVMQLE FMRDEQLDLP       300
     ILNSPAGYQG LAFCRVG                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page