(data stored in ACNUC7421 zone)

EMBL: CP000438.PE273

CP000438.PE273       Location/Qualifiers
FT   CDS             complement(306896..307666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15222"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK79"
FT                   /protein_id="ABJ15222.1"
FT                   /translation="MTSIDISNTRQLLERASNDDLEPLVEYILKANTESLSKQVDFKRS
FT                   HPEHRRYASSILDELRLFGGNSFVNLWRKSGPSYTEVVRDVASKLKVKGAGSMELIELE
FT                   EAMVQSILRQALEKSSGEDRRELEVILREAGLDKTKMTALLNGSALSGLVVPTVARLIL
FT                   YRTSTVIVNSMAQQLLGHGLRSAVVAGGTFAGGRAVAALAGPVGWVIAGIWTAVDLAGP
FT                   AYRVTIPCVLQIAMLRLKARAEAATDFMNGAFDG"
     MTSIDISNTR QLLERASNDD LEPLVEYILK ANTESLSKQV DFKRSHPEHR RYASSILDEL        60
     RLFGGNSFVN LWRKSGPSYT EVVRDVASKL KVKGAGSMEL IELEEAMVQS ILRQALEKSS       120
     GEDRRELEVI LREAGLDKTK MTALLNGSAL SGLVVPTVAR LILYRTSTVI VNSMAQQLLG       180
     HGLRSAVVAG GTFAGGRAVA ALAGPVGWVI AGIWTAVDLA GPAYRVTIPC VLQIAMLRLK       240
     ARAEAATDFM NGAFDG                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page