(data stored in ACNUC7421 zone)

EMBL: CP000438.PE274

CP000438.PE274       Location/Qualifiers
FT   CDS             complement(307985..308983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03370"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15223"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJQ8"
FT                   /protein_id="ABJ15223.1"
FT                   /translation="MAPPRLPQAQCLDAPPSPCRPASRCAGRSSWCASEPGHSTRPEHR
FT                   RLVHRTFKRNRSMSIIHDADLAGVLMSASADDIRLLIDVITDSGKGRISLSSAICRQLT
FT                   AAKEGEVGDYERALVAEELTRFGGNSLMNLFRGGSGVSYVELLSDVASHVGVSKAGTGD
FT                   CAQMEMAIIAKVVEQSIGRMSEEDKETFFESMGASYRPGMGAAALAALITSLSASSTAY
FT                   RLAAVVASATMSSLVGRGVAFAGGAAMGRGLAVLSGPVGWAITGIWTAFELASPAYRVT
FT                   VPCVIQIGHMRQKMLLKEGCPECHASTPAGSKFCSSCGARLASRLPHSIHD"
     MAPPRLPQAQ CLDAPPSPCR PASRCAGRSS WCASEPGHST RPEHRRLVHR TFKRNRSMSI        60
     IHDADLAGVL MSASADDIRL LIDVITDSGK GRISLSSAIC RQLTAAKEGE VGDYERALVA       120
     EELTRFGGNS LMNLFRGGSG VSYVELLSDV ASHVGVSKAG TGDCAQMEMA IIAKVVEQSI       180
     GRMSEEDKET FFESMGASYR PGMGAAALAA LITSLSASST AYRLAAVVAS ATMSSLVGRG       240
     VAFAGGAAMG RGLAVLSGPV GWAITGIWTA FELASPAYRV TVPCVIQIGH MRQKMLLKEG       300
     CPECHASTPA GSKFCSSCGA RLASRLPHSI HD                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page