(data stored in ACNUC7421 zone)

EMBL: CP000438.PE275

CP000438.PE275       Location/Qualifiers
FT   CDS             309749..311728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15224"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP9"
FT                   /protein_id="ABJ15224.1"
FT                   /translation="MRLKKRHDPMIALEAAQSFTKRELCVPLARWISDFLSRRGLQKPD
FT                   GRPLFAYKTSSEEFRALRQLLQNLPGGQQVSPSYPQAWLLFAAEWWKREYSGGAWRWGP
FT                   LCEAAGQRGLSHEKTRKLVIEGRRQWCLQTAIKNEGKRFIGLVAVNGGLPMRLVESAQG
FT                   GLSGLLRMVTLQAVDYDLHDEQLRQAIEAQAALLPACYQQAPVYELLDNLIKAVLHIRR
FT                   TYALKGTQDPIAKLQEECPQWEELFPIALDSQAAASLIKGLVRVTVSITPQSRRPPFQI
FT                   QRGLRFSSDGSMPVYELSFAMQAQAKRDQVAESLGLAADRLPPHFQLLLRIGEREHLVG
FT                   EALLRDDEYQLIARPLPSIQTVHEAAQLIVSRWGATLHIANLPGGEALSHDEPLIFENT
FT                   YPFARLIAQGDALVKGLSALAVMPARTIVLAEEGETRELHDCLADGQMLMELPAGKTRL
FT                   AYRGQAFIVTISASATHRPEAYWQGNSLEALSVPGLLFRGTPHLRVDQGLGHSSYAPSH
FT                   ELFVRSHSKELPLGEAQAPGLCRLIWRKDGQRLLSTRAVLLPEGASITYVPAASTLEGT
FT                   IRLDNWPDVPVRCENEEIELDSRHDGTNLVLRLKSTSARPATSVPLCMQWPDGEHRLTL
FT                   PFPGYGVTLQRNNLMWLIRVAVRL"
     MRLKKRHDPM IALEAAQSFT KRELCVPLAR WISDFLSRRG LQKPDGRPLF AYKTSSEEFR        60
     ALRQLLQNLP GGQQVSPSYP QAWLLFAAEW WKREYSGGAW RWGPLCEAAG QRGLSHEKTR       120
     KLVIEGRRQW CLQTAIKNEG KRFIGLVAVN GGLPMRLVES AQGGLSGLLR MVTLQAVDYD       180
     LHDEQLRQAI EAQAALLPAC YQQAPVYELL DNLIKAVLHI RRTYALKGTQ DPIAKLQEEC       240
     PQWEELFPIA LDSQAAASLI KGLVRVTVSI TPQSRRPPFQ IQRGLRFSSD GSMPVYELSF       300
     AMQAQAKRDQ VAESLGLAAD RLPPHFQLLL RIGEREHLVG EALLRDDEYQ LIARPLPSIQ       360
     TVHEAAQLIV SRWGATLHIA NLPGGEALSH DEPLIFENTY PFARLIAQGD ALVKGLSALA       420
     VMPARTIVLA EEGETRELHD CLADGQMLME LPAGKTRLAY RGQAFIVTIS ASATHRPEAY       480
     WQGNSLEALS VPGLLFRGTP HLRVDQGLGH SSYAPSHELF VRSHSKELPL GEAQAPGLCR       540
     LIWRKDGQRL LSTRAVLLPE GASITYVPAA STLEGTIRLD NWPDVPVRCE NEEIELDSRH       600
     DGTNLVLRLK STSARPATSV PLCMQWPDGE HRLTLPFPGY GVTLQRNNLM WLIRVAVRL        659
//

If you have problems or comments...

PBIL Back to PBIL home page