(data stored in ACNUC7421 zone)

EMBL: CP000438.PE276

CP000438.PE276       Location/Qualifiers
FT   CDS             complement(311665..312174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15225"
FT                   /db_xref="GOA:A0A0H2ZKK3"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR022000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK3"
FT                   /protein_id="ABJ15225.1"
FT                   /translation="MGKIVARKETGNLFFDFRYLGKRCREQTALPDTPTNRKKLEKILE
FT                   RIEAEITLGTFDYNEYFPQSGRADELSRLKAGISRLKVPQFKDFAQLWFDEKKMEWRDS
FT                   HTNTVRLTLEKYLLPTFGKQEVSAITKADILAFRSALGKVPGQKGQSLTATRINHIRLL
FT                   RCSVTP"
     MGKIVARKET GNLFFDFRYL GKRCREQTAL PDTPTNRKKL EKILERIEAE ITLGTFDYNE        60
     YFPQSGRADE LSRLKAGISR LKVPQFKDFA QLWFDEKKME WRDSHTNTVR LTLEKYLLPT       120
     FGKQEVSAIT KADILAFRSA LGKVPGQKGQ SLTATRINHI RLLRCSVTP                   169
//

If you have problems or comments...

PBIL Back to PBIL home page