(data stored in ACNUC7421 zone)

EMBL: CP000438.PE277

CP000438.PE277       Location/Qualifiers
FT   CDS             complement(312167..312499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15226"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW6"
FT                   /protein_id="ABJ15226.1"
FT                   /translation="MSQKQLESLIRLINITFDPNSSYLIHLNPERVMNEIYLTTDELSQ
FT                   RIKYDARTIRNCLKDSVLLEGIHYFRPFGGRKILFIWEAVERDMVKFSRENGFGIPMAN
FT                   GGICRG"
     MSQKQLESLI RLINITFDPN SSYLIHLNPE RVMNEIYLTT DELSQRIKYD ARTIRNCLKD        60
     SVLLEGIHYF RPFGGRKILF IWEAVERDMV KFSRENGFGI PMANGGICRG                  110
//

If you have problems or comments...

PBIL Back to PBIL home page