(data stored in ACNUC7421 zone)

EMBL: CP000438.PE278

CP000438.PE278       Location/Qualifiers
FT   CDS             complement(313222..313638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK82"
FT                   /protein_id="ABJ15227.1"
FT                   /translation="MSSGSTSTTPRAWLSGSVVTGKCCLLVIRKGQRPGVPFPAPCASG
FT                   VAVTGRPPCATGGRGRTRPPTGVGEDTKDSCGKGIADETPRRHHGGPAARKAGRATGRS
FT                   ERGHSRGTRPAELMPIPRSPVVVALGAFEISNES"
     MSSGSTSTTP RAWLSGSVVT GKCCLLVIRK GQRPGVPFPA PCASGVAVTG RPPCATGGRG        60
     RTRPPTGVGE DTKDSCGKGI ADETPRRHHG GPAARKAGRA TGRSERGHSR GTRPAELMPI       120
     PRSPVVVALG AFEISNES                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page