(data stored in ACNUC7421 zone)

EMBL: CP000438.PE28

CP000438.PE28        Location/Qualifiers
FT   CDS             29917..30519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIX3"
FT                   /protein_id="ABJ14984.1"
FT                   /translation="MKRWLGVALGCSGLAIALACAGVLLAPADMAASSSSPPPARTVAA
FT                   LPAVDDRPPPLAPVRSQAVAPAYEAEPPAAELDREQAIQFMQMLRDEGDPRSPPLGGLQ
FT                   PRQGATAQELADPKQYQAFEERQTRELVQAYTSGVQQIPEIRARIEAAEQGGERSAEEI
FT                   DEARAALGQLEMMRDKLQRESPQLLPGDSAPTSPAAP"
     MKRWLGVALG CSGLAIALAC AGVLLAPADM AASSSSPPPA RTVAALPAVD DRPPPLAPVR        60
     SQAVAPAYEA EPPAAELDRE QAIQFMQMLR DEGDPRSPPL GGLQPRQGAT AQELADPKQY       120
     QAFEERQTRE LVQAYTSGVQ QIPEIRARIE AAEQGGERSA EEIDEARAAL GQLEMMRDKL       180
     QRESPQLLPG DSAPTSPAAP                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page