(data stored in ACNUC7421 zone)

EMBL: CP000438.PE284

CP000438.PE284       Location/Qualifiers
FT   CDS             320329..320736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15233"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJR8"
FT                   /protein_id="ABJ15233.1"
FT                   /translation="MKANRSIACLLLAALPTLASAHAAEKVETLRDQALAEIPGHRGLM
FT                   LTVSFKPGQVSAPHVHPGSVFVYVLEGTVQTQLEGGPVETYTVGQSWYEPANVPHLLAR
FT                   NPDPMKPAKLLVWELLKEGDPILKPLERGAH"
     MKANRSIACL LLAALPTLAS AHAAEKVETL RDQALAEIPG HRGLMLTVSF KPGQVSAPHV        60
     HPGSVFVYVL EGTVQTQLEG GPVETYTVGQ SWYEPANVPH LLARNPDPMK PAKLLVWELL       120
     KEGDPILKPL ERGAH                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page