(data stored in ACNUC7421 zone)

EMBL: CP000438.PE285

CP000438.PE285       Location/Qualifiers
FT   CDS             320770..321054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15234"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR0"
FT                   /protein_id="ABJ15234.1"
FT                   /translation="MSASQVIRIRARNGQSERLGLRLQQLVEPGLEAPGCLEYQVRRDA
FT                   LEPDLWLVCSQWREAQQMFDYLAGGIQQVFAEVLWRSLAASLEVQDDAG"
     MSASQVIRIR ARNGQSERLG LRLQQLVEPG LEAPGCLEYQ VRRDALEPDL WLVCSQWREA        60
     QQMFDYLAGG IQQVFAEVLW RSLAASLEVQ DDAG                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page