(data stored in ACNUC7421 zone)

EMBL: CP000438.PE288

CP000438.PE288       Location/Qualifiers
FT   CDS             complement(323410..324180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK91"
FT                   /protein_id="ABJ15237.1"
FT                   /translation="MPRPALPAVLCLCCLLLALPARAALDDQQRALQQLQVQACRAVGS
FT                   LLLLRGEGFQEQHAAQLEKDLASLDRALAAAPEGVLLRQGERALVARIREGAAYGPREE
FT                   DLPWRYPQQLSRALRDFLNLVERQVPPPPPGQPLPLWQLPVRVEYLSLQYLARAYLGGL
FT                   EIAREQPRDYLGQDESVLVPLIDRRIALLVAQSANPAGLKKLENRWEYLSQALRDLNSK
FT                   SSALVSASGRPWAPIIVDRHARALSESLMRLSAE"
     MPRPALPAVL CLCCLLLALP ARAALDDQQR ALQQLQVQAC RAVGSLLLLR GEGFQEQHAA        60
     QLEKDLASLD RALAAAPEGV LLRQGERALV ARIREGAAYG PREEDLPWRY PQQLSRALRD       120
     FLNLVERQVP PPPPGQPLPL WQLPVRVEYL SLQYLARAYL GGLEIAREQP RDYLGQDESV       180
     LVPLIDRRIA LLVAQSANPA GLKKLENRWE YLSQALRDLN SKSSALVSAS GRPWAPIIVD       240
     RHARALSESL MRLSAE                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page