(data stored in ACNUC7421 zone)

EMBL: CP000438.PE290

CP000438.PE290       Location/Qualifiers
FT   CDS             325051..325566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03590"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15239"
FT                   /db_xref="GOA:A0A0H2ZKR7"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR7"
FT                   /protein_id="ABJ15239.1"
FT                   /translation="MKTLVDHLAQYAAYHRDRRNIFSHFIGIPMIVLSIAVLLARPALG
FT                   FGLSPALLLALAAALFYLRLDLRFGAAMTALLALTVWGAAQLAAGTTAAWLGWGVGLFV
FT                   VGWIIQFVGHYYEGRKPAFVDDLSGLIVGPLFVLAELAFLLGLRGDVQREVEERAGPTC
FT                   IREHKRAA"
     MKTLVDHLAQ YAAYHRDRRN IFSHFIGIPM IVLSIAVLLA RPALGFGLSP ALLLALAAAL        60
     FYLRLDLRFG AAMTALLALT VWGAAQLAAG TTAAWLGWGV GLFVVGWIIQ FVGHYYEGRK       120
     PAFVDDLSGL IVGPLFVLAE LAFLLGLRGD VQREVEERAG PTCIREHKRA A                171
//

If you have problems or comments...

PBIL Back to PBIL home page