(data stored in ACNUC7421 zone)

EMBL: CP000438.PE292

CP000438.PE292       Location/Qualifiers
FT   CDS             complement(326536..327288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03620"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15241"
FT                   /db_xref="GOA:A0A0H2ZKY0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY0"
FT                   /protein_id="ABJ15241.1"
FT                   /translation="MSVDLHALIPLIALTFLLAGFVKGVVGLGLPTVSVGLLGLAMPPM
FT                   QAAALLIVPSMVTNLWQLACGPRFLGLMKRLAGLLLGVVVGTLLVGAWLGGDAPRQATG
FT                   VLGLALAAYALLGLAAIPLHLPARHEPWAGPLVGLATGALTAVTGVFVIPAVPYLGALR
FT                   LQRDELVQALGLSFSASTLALAVTLGVHGDLLEPQMLGASLLTLVPALGGMLLGQWLRQ
FT                   RISATLFRRCFFVGLLLLGADLAWRGFH"
     MSVDLHALIP LIALTFLLAG FVKGVVGLGL PTVSVGLLGL AMPPMQAAAL LIVPSMVTNL        60
     WQLACGPRFL GLMKRLAGLL LGVVVGTLLV GAWLGGDAPR QATGVLGLAL AAYALLGLAA       120
     IPLHLPARHE PWAGPLVGLA TGALTAVTGV FVIPAVPYLG ALRLQRDELV QALGLSFSAS       180
     TLALAVTLGV HGDLLEPQML GASLLTLVPA LGGMLLGQWL RQRISATLFR RCFFVGLLLL       240
     GADLAWRGFH                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page