(data stored in ACNUC7421 zone)

EMBL: CP000438.PE299

CP000438.PE299       Location/Qualifiers
FT   CDS             complement(332467..334749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03720"
FT                   /product="putative sensory box/GGDEF domain/EAL domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15248"
FT                   /db_xref="GOA:A0A0H2ZJT3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJT3"
FT                   /protein_id="ABJ15248.1"
FT                   /translation="MSPRLSALRLSLAYLAIAIAWAFLSDHLLQNQVQDHDQLVFWMTA
FT                   KRLFFFAATGLLLYLYLVRQFRRKAQAYDELHGSEQRLNRALEAVRDGLWDWDLVTDRM
FT                   FVSPGYAALIGLAPEELGDPIETWKKRLHPEEYATVLEAHRNHLQGLTDNLDHIYRLRH
FT                   KDGDYRWIHSRGRVLRDALGKPLHYTGVARDITLQRLKEDHLRQAAAVFDSTREGVLVT
FT                   DAQAVIVHVNPSFERITGYRSEDVLGKTPAILRSGRQDQAFYQRLWLALREQDVWSGEI
FT                   WNRRKSGEIYPQWLHIRAVRNDQGQLTHYVGVFSDLSSIKRSENELDFLAHHDSLTGLP
FT                   NRVLLRERIEQALENGKDRTVAGALLLIDLDHFKHINDSLGHTTGDMLLKEVSKRLQHQ
FT                   LDERCLLSRLGGDEFAILVENDDPEAVARLSQRILDGFNAPFDIHCQPIYISASLGVSL
FT                   YPEDASDVDHLMQHADAALFQAKDSGRNAYAFYTRVLTARARAHVQVESALRHALEHDE
FT                   LRVHYQPVHDLASGRIVGVESLVRWQHPERGLVPPGEFVPVAEECGLIAALDNWVLKRA
FT                   CRQMREWQQRGVELEFVAVNVSSRLFNRGGLEERIANALEESGLEPRYLELEVTESAVM
FT                   EDFEQSLNLLCRLRILGVNLAIDDFGTGYSSLMRLKRLPVHKLKIDQGFVAGLPGAVDD
FT                   AAIARAIVALAQSMGLRVVAEGIEHQDQALFLREHGCDFGQGYWYGRPQPAEALRFDLP
FT                   PVALPED"
     MSPRLSALRL SLAYLAIAIA WAFLSDHLLQ NQVQDHDQLV FWMTAKRLFF FAATGLLLYL        60
     YLVRQFRRKA QAYDELHGSE QRLNRALEAV RDGLWDWDLV TDRMFVSPGY AALIGLAPEE       120
     LGDPIETWKK RLHPEEYATV LEAHRNHLQG LTDNLDHIYR LRHKDGDYRW IHSRGRVLRD       180
     ALGKPLHYTG VARDITLQRL KEDHLRQAAA VFDSTREGVL VTDAQAVIVH VNPSFERITG       240
     YRSEDVLGKT PAILRSGRQD QAFYQRLWLA LREQDVWSGE IWNRRKSGEI YPQWLHIRAV       300
     RNDQGQLTHY VGVFSDLSSI KRSENELDFL AHHDSLTGLP NRVLLRERIE QALENGKDRT       360
     VAGALLLIDL DHFKHINDSL GHTTGDMLLK EVSKRLQHQL DERCLLSRLG GDEFAILVEN       420
     DDPEAVARLS QRILDGFNAP FDIHCQPIYI SASLGVSLYP EDASDVDHLM QHADAALFQA       480
     KDSGRNAYAF YTRVLTARAR AHVQVESALR HALEHDELRV HYQPVHDLAS GRIVGVESLV       540
     RWQHPERGLV PPGEFVPVAE ECGLIAALDN WVLKRACRQM REWQQRGVEL EFVAVNVSSR       600
     LFNRGGLEER IANALEESGL EPRYLELEVT ESAVMEDFEQ SLNLLCRLRI LGVNLAIDDF       660
     GTGYSSLMRL KRLPVHKLKI DQGFVAGLPG AVDDAAIARA IVALAQSMGL RVVAEGIEHQ       720
     DQALFLREHG CDFGQGYWYG RPQPAEALRF DLPPVALPED                             760
//

If you have problems or comments...

PBIL Back to PBIL home page