(data stored in ACNUC7421 zone)

EMBL: CP000438.PE30

CP000438.PE30        Location/Qualifiers
FT   CDS             complement(32081..33004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00360"
FT                   /product="putative glycine betaine/L-proline ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14986"
FT                   /db_xref="GOA:A0A0H2ZJZ0"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ0"
FT                   /protein_id="ABJ14986.1"
FT                   /translation="MNRLPTCLLAATLFLGSASLYAEDPACARVRLADPGWSDIAVTNA
FT                   TAAFLLESLGYQVKIDTLSVPIIYGGLRDGQVDAFLGGWMPAHQDYHDKFVASGQVERL
FT                   ARNLDGTRFTLAVPRYVWDAGVHRFEDLAAQGQRFNRKLYGIGSGAPANQSIQKMIDAN
FT                   QFGLGDWKLVESSEQAMLAELGRAEKRQRWLVFLGWTPHPMNIRHDLRYLEGGEQYFGD
FT                   RGQVYTLARKGYAAQCPNPARLLANLRFDLDMENRLMSDALEGTATPASATRAWLKANP
FT                   RVLEAWLQGVTSRDGGDALAAVRGQP"
     MNRLPTCLLA ATLFLGSASL YAEDPACARV RLADPGWSDI AVTNATAAFL LESLGYQVKI        60
     DTLSVPIIYG GLRDGQVDAF LGGWMPAHQD YHDKFVASGQ VERLARNLDG TRFTLAVPRY       120
     VWDAGVHRFE DLAAQGQRFN RKLYGIGSGA PANQSIQKMI DANQFGLGDW KLVESSEQAM       180
     LAELGRAEKR QRWLVFLGWT PHPMNIRHDL RYLEGGEQYF GDRGQVYTLA RKGYAAQCPN       240
     PARLLANLRF DLDMENRLMS DALEGTATPA SATRAWLKAN PRVLEAWLQG VTSRDGGDAL       300
     AAVRGQP                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page