(data stored in ACNUC7421 zone)

EMBL: CP000438.PE304

CP000438.PE304       Location/Qualifiers
FT   CDS             339852..340823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03790"
FT                   /product="putative sensory box/GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15253"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJT9"
FT                   /protein_id="ABJ15253.1"
FT                   /translation="MDDLPGIPEDPQEAALALLHSRAEVARLKEREQLFSALLASVNSV
FT                   LWAYDWQNRRMVYVSPAYEKIFGRSAALLLADYEEWRNSIYPDDLDYADSSLLQVLERG
FT                   AVEQREYRIVRGDGEVRWLNDKCFVSRQGEAGLPLMVVGIAEDITDKKHMESELQRLAT
FT                   TDVLTQSSNRRYFFDSAEAAFKECRREGIPLAFLLLDVDDFKKINDRFGHQVGDQVLQR
FT                   IAQSGSAALRRGDLFGRIGGEEFAVLLPGCDEQTARQIGERLQREVQRLRFQEGEQSFG
FT                   ITVSQGLTVLQADDEGLGALYSRADAAMYSAKRQGKDCIVVG"
     MDDLPGIPED PQEAALALLH SRAEVARLKE REQLFSALLA SVNSVLWAYD WQNRRMVYVS        60
     PAYEKIFGRS AALLLADYEE WRNSIYPDDL DYADSSLLQV LERGAVEQRE YRIVRGDGEV       120
     RWLNDKCFVS RQGEAGLPLM VVGIAEDITD KKHMESELQR LATTDVLTQS SNRRYFFDSA       180
     EAAFKECRRE GIPLAFLLLD VDDFKKINDR FGHQVGDQVL QRIAQSGSAA LRRGDLFGRI       240
     GGEEFAVLLP GCDEQTARQI GERLQREVQR LRFQEGEQSF GITVSQGLTV LQADDEGLGA       300
     LYSRADAAMY SAKRQGKDCI VVG                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page