(data stored in ACNUC7421 zone)

EMBL: CP000438.PE309

CP000438.PE309       Location/Qualifiers
FT   CDS             complement(345887..346948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03855"
FT                   /product="probable periplasmic polyamine binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03855"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15639"
FT                   /db_xref="GOA:A0A0H2ZM12"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZM12"
FT                   /protein_id="ABJ15639.1"
FT                   /translation="MPRLSALLFLALAPWLAQAEETLRVYNWNDYIDPQVLESFQKDTG
FT                   IRVEYHTFATAEELDKALRSGEAIDVAVPSHDTLPALLKDNLLRPLDFTQLPNRSHLDR
FT                   QLLSKLAAVDPDNRHAVPYLWGAVGLAINTPQAEAAYGGPLPNSWSLLFDASQSQRLKS
FT                   CGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAAEALHGLRPNLRYVDSERYIADLE
FT                   GGRLCLAMAWVGDALRAAKAGQPVSFEVPQEGSVLFIDNLVIPAGAQHPREAHRFIDYL
FT                   MQPKIAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPPEKLRPV
FT                   VDEIWKAFRGASH"
     MPRLSALLFL ALAPWLAQAE ETLRVYNWND YIDPQVLESF QKDTGIRVEY HTFATAEELD        60
     KALRSGEAID VAVPSHDTLP ALLKDNLLRP LDFTQLPNRS HLDRQLLSKL AAVDPDNRHA       120
     VPYLWGAVGL AINTPQAEAA YGGPLPNSWS LLFDASQSQR LKSCGISLLD APDETLAILL       180
     NYQGRNLGRT APSQVRRAAE ALHGLRPNLR YVDSERYIAD LEGGRLCLAM AWVGDALRAA       240
     KAGQPVSFEV PQEGSVLFID NLVIPAGAQH PREAHRFIDY LMQPKIAAQI TAATLYPSGN       300
     ADAAGFLDPA LRQQPGLYPD RDTSRRLFAL ETPPEKLRPV VDEIWKAFRG ASH              353
//

If you have problems or comments...

PBIL Back to PBIL home page