(data stored in ACNUC7421 zone)

EMBL: CP000438.PE321

CP000438.PE321       Location/Qualifiers
FT   CDS             complement(361977..362480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB4"
FT                   /protein_id="ABJ15269.1"
FT                   /translation="MSLRPTLALLALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLAD
FT                   VDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLKLLLDYAQAYNSGNVSD
FT                   DQASTLIERVDDLQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIGRQV
FT                   PLVE"
     MSLRPTLALL ALVSLPLMAA QNDPQPSSKE LMKEHQAQIQ NDLADVDYKR KRIVEANMNL        60
     TDQEGEKFWP IYNTYRTESD KLSKETLKLL LDYAQAYNSG NVSDDQASTL IERVDDLQED       120
     RLELRDKYVK RIAKNVSPKR AMRFLQIEIQ LDAIATLEIG RQVPLVE                     167
//

If you have problems or comments...

PBIL Back to PBIL home page