(data stored in ACNUC7421 zone)

EMBL: CP000438.PE322

CP000438.PE322       Location/Qualifiers
FT   CDS             complement(362585..363196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15271"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU0"
FT                   /protein_id="ABJ15271.1"
FT                   /translation="MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLAAYWWFEIRYI
FT                   RPFSEQTTLFSGDSLRLPAELAGPGAIRLVHFWDPACPCNVGNQQHLGELIERFAGKGV
FT                   EFHVLQKPGSQGRLPDNLAALRPLAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSEGAV
FT                   CTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWTPEKG"
     MASLAPVFRV NAMTPRRKTL LVSLVGLLWA GGLLAAYWWF EIRYIRPFSE QTTLFSGDSL        60
     RLPAELAGPG AIRLVHFWDP ACPCNVGNQQ HLGELIERFA GKGVEFHVLQ KPGSQGRLPD       120
     NLAALRPLAG LPGSEQLPAS PAVAIWDRDG RLAYFGPYSE GAVCTSSNSF IEPILEALLQ       180
     GRPVDATHTL AVGCYCPWTP EKG                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page