(data stored in ACNUC7421 zone)

EMBL: CP000438.PE324

CP000438.PE324       Location/Qualifiers
FT   CDS             complement(364234..364986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN8"
FT                   /protein_id="ABJ15272.1"
FT                   /translation="MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAAQ
FT                   KRYQDKLPPALYQTLVDNSNRRFAPAEVDQRALNGLRENLPDSASPLNFFESPLGRKVV
FT                   AAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVAADS
FT                   LSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRDLSDAELTQYVNFA
FT                   ESPSGRSYYQAALAALKAGLAVDQAVAP"
     MRALLAFALL LVGLPALADP YQRLYQAAGW PDQRAHFSDA LDAAQKRYQD KLPPALYQTL        60
     VDNSNRRFAP AEVDQRALNG LRENLPDSAS PLNFFESPLG RKVVAAEVLA TRRDQLLQHS       120
     NGLPRQTASE PRRALVKRLA QVLPAREAGA EVSLALAGVA ADSLSQMLPG LPGLLGGGQT       180
     GQLLEGQRQR LVQQIGADLE NTLLYVYRDL SDAELTQYVN FAESPSGRSY YQAALAALKA       240
     GLAVDQAVAP                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page