(data stored in ACNUC7421 zone)

EMBL: CP000438.PE326

CP000438.PE326       Location/Qualifiers
FT   CDS             complement(365755..366309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15274"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB9"
FT                   /protein_id="ABJ15274.1"
FT                   /translation="MLPTRSLLPFFLAPALLASAASQAAMEALDNDSLSQVTGQAGISL
FT                   RLDLRAGAARVAWVDDGGSLSLRNLVIDNGCVKAGDCPDGRGGNIPLGAAQLGLSLPIF
FT                   GVEQPTLALDVTTGSGGGQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLYIGDNS
FT                   IGRIELRDITDLRGTIKVWGH"
     MLPTRSLLPF FLAPALLASA ASQAAMEALD NDSLSQVTGQ AGISLRLDLR AGAARVAWVD        60
     DGGSLSLRNL VIDNGCVKAG DCPDGRGGNI PLGAAQLGLS LPIFGVEQPT LALDVTTGSG       120
     GGQQLAISLP DLATINDQLI ASGLPAQRIR LRVASDLYIG DNSIGRIELR DITDLRGTIK       180
     VWGH                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page