(data stored in ACNUC7421 zone)

EMBL: CP000438.PE327

CP000438.PE327       Location/Qualifiers
FT   CDS             366575..367069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15275"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJW0"
FT                   /protein_id="ABJ15275.1"
FT                   /translation="MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWHAQGRIVALCPEVA
FT                   GGLPTPRPPAEIPGGQGGEVLDRLNRVFTVDGEDVSEAFLLGAEAAVELVRRHDIRMAV
FT                   LKARSPSCGNLENYDGRFNGSRVAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGLDAG
FT                   G"
     MQKVLVSRCL LGHLVRYDGG SHGPFDLLSR WHAQGRIVAL CPEVAGGLPT PRPPAEIPGG        60
     QGGEVLDRLN RVFTVDGEDV SEAFLLGAEA AVELVRRHDI RMAVLKARSP SCGNLENYDG       120
     RFNGSRVAGE GVTAAALKRM GVLVFNEDEL DRAAVCLAGL DAGG                        164
//

If you have problems or comments...

PBIL Back to PBIL home page