(data stored in ACNUC7421 zone)

EMBL: CP000438.PE330

CP000438.PE330       Location/Qualifiers
FT   CDS             368901..369338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04100"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15278"
FT                   /db_xref="InterPro:IPR025512"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL15"
FT                   /protein_id="ABJ15278.1"
FT                   /translation="MRVTLPCLGLAALMFGASASLMAADLPRTKAPEGAKVYFITPADG
FT                   ATVDKTFTVKFGLKGMGVAPAGVDMPDTGHHHLLVDLKEQPAMNLPLPMTDNIRHFGKG
FT                   QTETEITLPPGKHTLQLLVGDKNHVPLEPTVESEKITVTVK"
     MRVTLPCLGL AALMFGASAS LMAADLPRTK APEGAKVYFI TPADGATVDK TFTVKFGLKG        60
     MGVAPAGVDM PDTGHHHLLV DLKEQPAMNL PLPMTDNIRH FGKGQTETEI TLPPGKHTLQ       120
     LLVGDKNHVP LEPTVESEKI TVTVK                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page