(data stored in ACNUC7421 zone)

EMBL: CP000438.PE335

CP000438.PE335       Location/Qualifiers
FT   CDS             374152..374502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15283"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL19"
FT                   /protein_id="ABJ15283.1"
FT                   /translation="MKLRHLPLIAAIGLFSTVTLAAGYTGPGATPTTTTVKAALEAADD
FT                   TPVVLQGTIVKRIKGDIYEFRDATGSMKVEIDDEDFPPMEINDKTRVKLTGEVDRDLVG
FT                   REIDVEFVEVIK"
     MKLRHLPLIA AIGLFSTVTL AAGYTGPGAT PTTTTVKAAL EAADDTPVVL QGTIVKRIKG        60
     DIYEFRDATG SMKVEIDDED FPPMEINDKT RVKLTGEVDR DLVGREIDVE FVEVIK           116
//

If you have problems or comments...

PBIL Back to PBIL home page